823114

Polyclonal Antibody to Myostatin (MSTN) Human

In Stock
In Stock
*
Please Email support@aspirachemical.com to place your order.

In Stock
In Stock
Products specifications
Antigen Myostatin (MSTN)
Reactivity Human
Host Rabbit
NCBI Accession RPB653Hu01
Concentration 200ug/ml
Conjugate No Conjugate
Immunogen Recombinant MSTN (Arg266~Ser375) expressed in E.coli.
Immunoglobulin Type IgG
Purification Affinity Chromatography
Specificity The antibody is a rabbit polyclonal antibody raised against MSTN. It has been selected for its ability to recognize MSTN in immunohistochemical staining and western blotting.
Application WB, ICC, IHC-P, IHC-F, ELISA
Amino Acid Sequence MGHHHHHHSGSEF-RDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Shipping Conditions 2 °C - 8 °C
Storage Temperature Store at 4 °C for frequent use. Store at -20 °C to -80 °C for one year without detectable loss of activity. Avoid repeated freeze-thaw cycles.
Handling Instruction Supplied as solution form in PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Notes All antibodies are custom made on-demand. Please allow 5-7 working days for production and 2-3 days for shipment.
Legal Information Marketed under license from USCN Life Science Inc.

Optimal working dilutions must be determined by end user.

Western blotting1:100-400
Immunocytochemistry in formalin fixed cells1:100-500
Immunohistochemistry in formalin fixed frozen section1:100-500
Immunohistochemistry in paraffin section1:50-200
Enzyme-linked Immunosorbent Assay1:100-200
Products specifications
Antigen Myostatin (MSTN)
Reactivity Human
Host Rabbit
NCBI Accession RPB653Hu01
Concentration 200ug/ml
Conjugate No Conjugate
Immunogen Recombinant MSTN (Arg266~Ser375) expressed in E.coli.
Immunoglobulin Type IgG
Purification Affinity Chromatography
Specificity The antibody is a rabbit polyclonal antibody raised against MSTN. It has been selected for its ability to recognize MSTN in immunohistochemical staining and western blotting.
Application WB, ICC, IHC-P, IHC-F, ELISA
Amino Acid Sequence MGHHHHHHSGSEF-RDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Shipping Conditions 2 °C - 8 °C
Storage Temperature Store at 4 °C for frequent use. Store at -20 °C to -80 °C for one year without detectable loss of activity. Avoid repeated freeze-thaw cycles.
Handling Instruction Supplied as solution form in PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Notes All antibodies are custom made on-demand. Please allow 5-7 working days for production and 2-3 days for shipment.
Legal Information Marketed under license from USCN Life Science Inc.